*Target (protein/gene name): 4-(cytidine 5' -diphospho)-2-C-methyl-D-erythritol kinase


*NCBI Gene # or RefSeq#: NCBI 112699

*Protein ID (NP or XP #) or Wolbachia#: Accession: CAN02442

*Organism (including strain): Bacillus anthracis, Strain: Ames Ancestor

*Etiologic Risk Group (see link below): Category A Priority Pathogens

*Disease Information (sort of like the Intro to your Mini Research Write up):
The bacterium Bacillus anthracis, mostly found in soil, causes anthrax. One of the reasons this disease is considered so dangerous is because of the capability of the bacterial cells to behave like bacterial spores which can survive extremely harsh conditions. These spores can last up do decades and thus livestock, such as cows grazing a field, can easily take up these spores years after a previous outbreak has occurred. Anthrax occurs in three forms: cutaneous (affects skin), inhalational (in the lungs), and gastrointestinal (digestive tract). Anthrax can also be used as a bioterrorism weapon and has been developed to do so by many nations in the past. However, what actually kills people is not the bacterium, but the toxins the bacterium releases. One toxin is the poly-D-glutamic acid capsule and the other is simply termed the anthrax capsule. If left untreated, anthrax will almost certainly prove to be lethal.

Link to TDR Targets page (if present): N/A

Link to Gene Database page (NCBI, EuPath databases -e.g. TryTryp, PlasmoDB, etc - or PATRIC, etc.): http://www.ncbi.nlm.nih.gov/gene/1088040

Essentiality of this protein:
Is it a monomer or multimer as biological unit? (make prediction at http://www.ebi.ac.uk/msd-srv/prot_int/pistart.html):
2 amino acid chains and 7 ligands

Complex of proteins? Yes

Druggable Target (cite evidence from a paper/database showing druggable in another organism): http://www.ncbi.nlm.nih.gov/pmc/articles/PMC2646905/

*EC#: 2.7.1.148

Link to BRENDA EC# page:http://www.brenda-enzymes.org/enzyme.php?ecno=2.7.1.148

imageedit_2_5980963598.png

Enzyme Assay information
-- Lik to Assay Information and Reagents: http://www.sciencedirect.com/science/article/pii/S1074552110000414
-- List cost and quantity of substrate reagents, supplier, and catalog #: https://www.atcc.org/Products/All/PTA-4173.aspx
Bacteriophage of Bacillus cereus- anthracis, MHWa; PTA-4173--$200.00

PDB Number: 4M0C
Current Inhibitors: unknown
Expression Information (has it been expressed in bacterial cells): Yes, it has been expressed in M. tuberculosis
Purification Method: Purified by column chromatography on Whatman fibrous cellulose using 2-propanol, methanol, and water (in a ratio of 4:2:4) solution

Image of protein (PyMol with features delineated and shown separately):

protein pic 1.jpg

Figure 1. The crystal structure of a FMN- dependent NADH-azoreductase from Bacillus anthracis str. Ames Ancestor in complex with FMN


*Amino Acid Sequence (paste as text only - not as screenshot or as 'code'):
SNA(MSE)NKTLIINAHPKVDDTSSVSIKVFKHFLESYKELISNN

ETIEQINLYDDVVP(MSE)IDKTVLSAWEKQGNGQELTREEQKVT

ER(MSE)SEILQQFKSANTYVIVLPLHNFNIPSKLKDY(MSE)DN

I(MSE)IARETFKYTETGSVGLLKDGRR(MSE)LVIQASGGIYTN

DDWYTDVEYSHKYLKA(MSE)FNFLGIEDYQIVRAQGTAVLDPTE

VLQNAYKEVEEAASRLANKYIFSLEE

Length of your protein in Amino Acids: 237
Molecular Weight of your protein in kiloDaltons using the Expasy ProtParam website: 27154.4 kDa
Molar Extinction coefficient of your protein at 280 nm wavelength: 28880 M-1 C-1
TMpred graph Image (http://www.ch.embnet.org/software/TMPRED_form.html). Input your amino acid sequence to it.
graph 1.gif

*CDS Gene Sequence (paste as text only):

*GC% Content for gene:
*CDS Gene Sequence (codon optimized) - copy from output of Primer Design Protocol (paste as text only):
*GC% Content for gene (codon optimized):