Target (protein/gene name): 6-phosphogluconate dehydrogrenase

*NCBI Gene # or RefSeq#:
*Protein ID (NP or XP #) or Wolbachia#: TGME49_242600-t26_1
*Organism (including strain): Toxoplasma gondii
Etiologic Risk Group (see link below):
*/Disease Information (sort of like the Intro to your Mini Research Write up): Toxoplasma gondii is a single-celled parasite that causes the disease known as toxoplasmosis. In the United States alone, more than 60 million people are infected with the parasite, however very few express symptoms because a healthy person's immune system usually keeps the parasite from causing illness. Pregnant women and individuals with compromised immune systems are the most at risk for contracting taxoplasmosis. The most common way of getting a taxoplasma infection is through the consumption or handling (and not washing hands properly) of undercooked meat.
Link to TDR Targets page (if present): http://www.tdrtargets.org/targets/view?gene_id=258054
Link to Gene Database page (NCBI, EuPath databases -e.g. TryTryp, PlasmoDB, etc - or PATRIC, etc.): http://toxodb.org/toxo/app/record/gene/TGME49_042600
Essentiality of this protein:
TGME49_042600 has essentiality data
Gene/Ortholog: mtu1874 (OG4_10600); Phenotype: non-essential; Source study: nmpdr
Gene/Ortholog: mtu1142 (OG4_10600); Phenotype: essential; Source study: nmpdr
Gene/Ortholog: eco1968 (OG4_10600); Phenotype: undefined; Source study: blattner
Gene/Ortholog: eco1968 (OG4_10600); Phenotype: non-essential; Source study: gerdes
Gene/Ortholog: eco1968 (OG4_10600); Phenotype: non-essential; Source study: keio
Gene/Ortholog: eco1968 (OG4_10600); Phenotype: non-essential; Source study: shigen
Gene/Ortholog: cel16317 (OG4_10600); Phenotype: Larval/Adult Lethal/Arrest; Source study: neb
Gene/Ortholog: cel16317 (OG4_10600); Phenotype: Embryonic Lethal/Arrest; Source study: neb
Gene/Ortholog: cel16317 (OG4_10600); Phenotype: Embryonic Lethal/Arrest; Source study: wormbase
Gene/Ortholog: cel16317 (OG4_10600); Phenotype: Larval/Adult Lethal/Arrest; Source study: wormbase
Gene/Ortholog: Tb09.211.3180 (OG4_10600); Phenotype: significant loss of fitness in bloodstream forms (3 days); Source study: alsford
Gene/Ortholog: Tb09.211.3180 (OG4_10600); Phenotype: significant loss of fitness in bloodstream forms (6 days); Source study: alsford
Gene/Ortholog: Tb09.211.3180 (OG4_10600); Phenotype: significant loss of fitness in procyclic forms; Source study: alsford
Gene/Ortholog: Tb09.211.3180 (OG4_10600); Phenotype: significant loss of fitness in differentiation of procyclic to bloodstream forms; Source study: alsford
Is it a monomer or multimer as biological unit? (make prediction at http://www.ebi.ac.uk/msd-srv/prot_int/pistart.html):
Complex of proteins?:
Druggable Target (list number or cite evidence from a paper/database showing druggable in another organism):
Druggability index (range: 0 to 1): 0.6
http://www.sciencedirect.com/science/article/pii/S0968089608001260
http://pubs.acs.org/doi/abs/10.1021/jm031066i

*EC#: 1.1.1.44
Link to BRENDA EC# page: http://www.brenda-enzymes.org/enzyme.php?ecno=1.1.1.44
-- Show screenshot of BRENDA enzyme mechanism schematic
Enzyme Assay information (spectrophotometric, coupled assay ?, reagents):
Method: Continuous Spectrophotometric Rate Determination
http://www.sigmaaldrich.com/content/dam/sigma-aldrich/docs/Sigma/Enzyme_Assay/6phosphoglucdehydrog75.pdf

--- List cost and quantity of substrate reagents, supplier, and catalog #

Structure (PDB or Homology model)
-- PDB # or closest PDB entry if using homology model: 2IYO
-- For Homology Model option:
---- Show pairwise alignment of your BLASTP search in NCBI against the PDB

Chain A, Structural Characterization Of A Bacterial 6pdh Reveals Aspects Of Specificity, Mechanism And Mode Of InhibitionSequence ID: 2IYO_ALength: 472Number of Matches: 1




Alignment statistics for match #1

Score
Expect
Method
Identities
Positives
Gaps
390 bits(1003)
1e-131
Compositional matrix adjust.
207/502(41%)
301/502(59%)
37/502(7%)
<span style="font-size: 11.869px;">Query  3    CDVGIYGLAVMGLGLSLNLASRGIRVSVCNRTSTKVDGALKQAKDENFEENIFGARTLED  62
             + G+ G+AVMG  L+LN+ SRG  V++ NRT++K +   K+ +D+N    +F  +TLE+
Sbjct  4    ANFGVVGMAVMGKNLALNVESRGYTVAIYNRTTSKTEEVFKEHQDKNL---VF-TKTLEE  59
 
Query  63   FVQSLKKPRRIIMVIEAGAPVDALINHLLPKLDAGDCLVDAGNEFFEVSEKRERLCASKG  122
            FV SL+KPRRI+++++AGA  DA I  LLP LD GD L+D GN  F  + +R    A  G
Sbjct  60   FVGSLEKPRRIMLMVQAGAATDATIKSLLPLLDIGDILIDGGNTHFPDTMRRNAELADSG  119
 
Query  123  VLFMDVGLCAGEGGARSGPPLTPGGSLEAWNLMEPIFVQLAGKIDASKTIPLPGALTVSD  182
            + F+  G+  GE GA  GP + PGG  EA++L+ PIF Q+A K       P  G
Sbjct  120  INFIGTGVSGGEKGALLGPSMMPGGQKEAYDLVAPIFEQIAAKA------PQDG------  167
 
Query  183  EEKQNACVSHLGPCGAGHYVKMVHNGIMYGDMQLIAEAHQLLKFACDLSNEELHVTFKKW  242
                  CV+++G  GAGHYVKMVHNGI YGDMQLIAE++ LLK    LSN E+   F++W
Sbjct  168  ----KPCVAYMGANGAGHYVKMVHNGIEYGDMQLIAESYDLLKRILGLSNAEIQAIFEEW  223
 
Query  243  NEDELHSYLLGITANIVRKKDSFTGGYLLDFIADTAGSKGTGKWTMQQAAELGVAVPTIT  302
            NE EL SYL+ IT  ++++KD    GY++D I D AG+KGTGKWT + A +LGV +P IT
Sbjct  224  NEGELDSYLIEITKEVLKRKDDEGEGYIVDKILDKAGNKGTGKWTSESALDLGVPLPLIT  283
 
Query  303  AALDMRYICSNQPLRQKMNCLYAQNWCSLVKTEDSTKEQRIESIRRALVCGRICCFAQGM  362
             ++  RYI + +  R K + + +             K++ IE IR+AL   +I  +AQG
Sbjct  284  ESVFARYISTYKDERVKASKVLSGPALDF----SGDKKEVIEKIRKALYFSKIMSYAQGF  339
 
Query  363  HLLRVISEQKGWGVDLSEVSRIWQAGCVIECDFLKVMQRAFRKKPDLESILLSEEVHTTV  422
              LR  SE+  W +    +++IW+AGC+I  +FL+ +  AF K  +LE++LL +
Sbjct  340  AQLRKASEEFDWDLPYGTIAQIWRAGCIIRAEFLQNITDAFDKDSELENLLLDDYFVDIT  399
 
Query  423  QNYLPALQEVISLSLGTATPRPDEPSVRITLPTPAHSASYNYLASSCGLRLSMNLVQAQR  482
            + Y  A+++V+SL++   T            P P  +++ +Y  S     L  NL+QAQR
Sbjct  400  KRYQEAVRDVVSLAVQAGT------------PIPTFTSAISYYDSYRSENLPANLIQAQR  447
 
Query  483  DCFGAHHFKRTDREGKYHVEDW  504
            D FGAH ++RTD+ G +H  DW
Sbjct  448  DYFGAHTYERTDKAGIFHY-DW  468</span>

---- Query Coverage: 99%
---- Max % Identities: 41%
---- % Positives: 59%
---- Chain used for homology: Chain A

Figure 1: PDB structure for Chain A, Structural Characterization Of A Bacterial 6-phosphogluconate dehydrogenase Reveals Aspects Of Specificity, Mechanism And Mode Of Inhibition
Figure 1: PDB structure for Chain A, Structural Characterization Of A Bacterial 6-phosphogluconate dehydrogenase Reveals Aspects Of Specificity, Mechanism And Mode Of Inhibition



Current Inhibitors: There are currently 381 inhibitors of this target.
Expression Information (has it been expressed in bacterial cells): Has not been expressed in bacterial cells.
Purification Method: Since it hasn't been expressed, there is no purification method for this target.
Image of protein (PyMol with features delineated and shown separately):
*Amino Acid Sequence (paste as text only - not as screenshot or as 'code'):
MSCDVGIYGLAVMGLGLSLNLASRGIRVSVCNRTSTKVDGALKQAKDENFEENIFGARTLEDFVQSLKKPRRIIMVIEAG
APVDALINHLLPKLDAGDCLVDAGNEFFEVSEKRERLCASKGVLFMDVGLCAGEGGARSGPPLTPGGSLEAWNLMEPIFV
QLAGKIDASKTIPLPGALTVSDEEKQNACVSHLGPCGAGHYVKMVHNGIMYGDMQLIAEAHQLLKFACDLSNEELHVTFK
KWNEDELHSYLLGITANIVRKKDSFTGGYLLDFIADTAGSKGTGKWTMQQAAELGVAVPTITAALDMRYICSNQPLRQKM
NCLYAQNWCSLVKTEDSTKEQRIESIRRALVCGRICCFAQGMHLLRVISEQKGWGVDLSEVSRIWQAGCVIECDFLKVMQ
RAFRKKPDLESILLSEEVHTTVQNYLPALQEVISLSLGTATPRPDEPSVRITLPTPAHSASYNYLASSCGLRLSMNLVQA
QRDCFGAHHFKRTDREGKYHVEDWGA

*length of your protein in Amino Acids: 506
Molecular Weight of your protein in kiloDaltons using the Expasy ProtParam website: 55586.93
Molar Extinction coefficient of your protein at 280 nm wavelength: 56015
TMpred graph Image (http://www.ch.embnet.org/software/TMPRED_form.html). Input your amino acid sequence to it.

results
results


*CDS Gene Sequence (paste as text only):

*GC% Content for gene:
*CDS Gene Sequence (codon optimized) - copy from output of Primer Design Protocol (paste as text only):
*GC% Content for gene (codon optimized):

Do Not Need this info for Spring (but still copy these lines to your Target page for now)
Primer design results for pNIC-Bsa4 cloning (list seqeunces of all of your ~40 nt long primers):
(link to DNA Works output text file - that should be saved in your Google Docs folder after you did the primer design protocol)
-- Ask a mentor, Dr. B, or a fellow researcher -how to link a GDocs file if you are not sure how to.

Primer design results for 'tail' primers (this is just 2 sequences):